PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB
Protein Properties Length: 316aa    MW: 35305.4 Da    PI: 9.1766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528337.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
   XP_010528337.1 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPVNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.59.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_010528337.1  67 RGNFTQHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.921961IPR017930Myb domain
SuperFamilySSF466891.84E-3011108IPR009057Homeodomain-like
SMARTSM007174.0E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001671.73E-101661No hitNo description
PROSITE profilePS5129423.65362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2565117IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.8E-1467112IPR001005SANT/Myb domain
CDDcd001673.12E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MVRPPCCEKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PVNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKIR  120
QTPQELDRSN KDRFSSSSSP SSSSANSNSN ISRGQWERRL QTDIHTARKA LYEALSPAVP  180
ISAVATATSS SSESKHSNSA SGFLCTQERS STYASSTENI AKLLKGWVKN STKTQNAPSQ  240
IASSDFDSKE EIKNEAGAEC RGAFQSFPGL EPYQSAVSPD ETKPIQSQWS LFEKWLFEDS  300
GGGIGDILFE ENPNFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-25141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529561e-115AK352956.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-09-D13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528337.10.0PREDICTED: myb-related protein 306
SwissprotQ9SCU71e-159MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0D3AWG21e-158A0A0D3AWG2_BRAOL; Uncharacterized protein
STRINGAT3G28910.11e-156(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-149myb domain protein 30